PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s720451g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family ARF
Protein Properties Length: 976aa    MW: 109306 Da    PI: 7.6019
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s720451g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.44.8e-22127228199
                        EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                        f+k+lt sd++++g +++p++ ae++       +++++e  +l+ +d++  sW++++iyr++++r++lt+GW+ F + ++L +gD+v+F   
  PDK_30s720451g002 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldytMQPPAE--ELIAKDLHDISWTFRHIYRGQPKRHLLTTGWSVFISTKRLVAGDSVLFI-- 214
                        99******************************6555544..8************************************************.. PP

                        SSSEE..EEEEE-S CS
                 B3  86 grsefelvvkvfrk 99 
                        ++++ +l+++++r+
  PDK_30s720451g002 215 RDEKSQLLLGIRRA 228
                        45677789999997 PP

2Auxin_resp124.95.4e-41253335183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        aahaa+++s+F+++YnPras+seFv++++k++ka++++vs+GmRf+m+fete+s  rr++Gt++g++dldpvrW+nS+Wr+L+
  PDK_30s720451g002 253 AAHAAANNSPFTIFYNPRASPSEFVIPFAKYHKAMYTQVSLGMRFRMMFETEESGVRRYMGTITGINDLDPVRWKNSQWRNLQ 335
                        79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.01E-43117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-40119242IPR015300DNA-binding pseudobarrel domain
CDDcd100178.59E-20126227No hitNo description
PfamPF023626.0E-20127228IPR003340B3 DNA binding domain
SMARTSM010194.0E-23127229IPR003340B3 DNA binding domain
PROSITE profilePS5086311.97127229IPR003340B3 DNA binding domain
PfamPF065074.3E-36253335IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 976 aa     Download sequence    Send to blast
MKGPGSNGFA ENPAEGERKS ISSELWHACA GPLVSLPPAG SLVVYFPQGH SEQVAASMQK  60
VTDSMPNYPS LPSKLICVLH NVTLHADAET DEVYAQMTLQ PVNKYDREAM LASEMGLKQN  120
KQPTEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDYTM QPPAEELIAK DLHDISWTFR  180
HIYRGQPKRH LLTTGWSVFI STKRLVAGDS VLFIRDEKSQ LLLGIRRANR QQPPLSSSVL  240
SSDSMHIGIL AAAAHAAANN SPFTIFYNPR ASPSEFVIPF AKYHKAMYTQ VSLGMRFRMM  300
FETEESGVRR YMGTITGIND LDPVRWKNSQ WRNLQVGWDE STATERRTRV SIWEIEPVAT  360
PFYICPPPFF KPKFSKQPGM PDDKIEIENT FNRVMPWLGD DFGLKDAQSA VFPGLSLVQW  420
MAVQQNSQLM APAAQSTNFP STAASPCSKL NPHTHQFDRY HQPPLLSSQQ PLRPQQQISI  480
HHHHHQRQQQ QQPPPVQQNT AHLMQLHQQQ QQQQQAELQQ QQFQQQQTRP AASQELIDQQ  540
QQKQHQPIRS QILPQTQLSN QLLRQQQAEL QQQQFQQQQT RPAASQELID QQQQKQHQPI  600
RSQIFPQTQL SNQLLQPPSS NVQQQGLPKP STQHQQGACS PNLGSLQPSS LPQILQVQQP  660
VDHQNTLFQQ QQQQLQQLMQ PQHQLQLLQK LQEQQLISQL SPQLQSQSSQ QLTQQNQHFQ  720
QQQNLQPQLN GTNILPSQLK QLQQMPTMDN SNYLKPQLPA RAHSTLNENK APSCSTSPST  780
NCHSSSSLIN RVQQGPAVLI GETGVPHMEI LLQELRSKSD VQVKRELHST KEPAQLPNQH  840
ATVNQLDASS ATSFCLDGSA HEGISLPPIL DGDVQVDPRD NLLVGTYGDG LMPDALLSRC  900
LGSGKDIQNL LSGYGNQGDV ETELSTAAIS SQSFGVPHMP FKPGCSSDAA ANESGVLNQG  960
FWSGQPQRMR TYTKVC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1691635645388Auxin response factor 5
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792838.10.0PREDICTED: auxin response factor 16-like
TrEMBLC5Z6000.0C5Z600_SORBI; Auxin response factor
STRINGSb10g006440.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140935106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19